DHRS7B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DHRS7B Polyclonal antibody, PBS Only (15530-1-PBS)

• 

  WB analysis using 15530-1-AP (same clone as 15530-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15530-1-AP (DHRS7B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 15530-1-AP (same clone as 15530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 15530-1-AP (DHRS7B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 15530-1-AP (same clone as 15530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 15530-1-AP (DHRS7B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15530-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 15530-1-AP (same clone as 15530-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using DHRS7B antibody (15530-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 15530-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 15530-1-AP (same clone as 15530-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using DHRS7B antibody (15530-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 15530-1-PBS in a different storage buffer formulation.

DHRS7B Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15530-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CGI 93, CGI-93, EC:1.1.-.-, Protein SDR32C1, SDR32C1

---

Product Information

15530-1-PBS targets DHRS7B in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7690

  Product name: Recombinant human DHRS7B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 145-325 aa of BC004126

  Sequence: ISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSKNS

• Full Name: dehydrogenase/reductase (SDR family) member 7B
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC004126
• Gene Symbol: DHRS7B
• Gene ID (NCBI): 25979
• RRID: AB_3741866
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IAN0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DHRS7B (Dehydrogenase/Reductase 7B) is a member of the short-chain dehydrogenase/reductase (SDR) superfamily, a group of enzymes involved in redox reactions, particularly the metabolism of steroids, lipids, and xenobiotics. DHRS7B is characterized by its NAD(P)H-dependent oxidoreductase activity and plays roles in cellular detoxification, lipid homeostasis, and possibly steroid hormone regulation.