DIAPH2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84671-4-RR (same clone as 84671-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84671-4-RR (DIAPH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84671-4-PBS in a different storage buffer formulation.

DIAPH2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84671-4-PBS

Clone No.242176A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

242176A11, DIA, DIA2, DRF2

---

Product Information

84671-4-PBS targets DIAPH2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35280

  Product name: Recombinant human DIAPH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 13-146 aa of NM_006729.4

  Sequence: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT

• Full Name: diaphanous homolog 2 (Drosophila)
• Calculated Molecular Weight: 126kDa
• Observed Molecular Weight: 126-130 kDa
• GenBank Accession Number: NM_006729.4
• Gene Symbol: DIAPH2
• Gene ID (NCBI): 1730
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O60879
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

In vertebrates, three DRF genes (DIAPH1, DIAPH2 and DIAPH3) are the orthologs of the Drosophila melanogaster diaphanous (dia) gene, which has important roles in fertility and hearing in the fly. DIAPH1 and DIAPH3 have been associated with different types of hearing loss (HL). DIAPH2, located on chromosome Xq21.33, until now it has only been linked to premature ovarian failure 2 (POF2A). (PMID: 36689403)