DIRC2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DIRC2 Polyclonal antibody (26750-1-AP)

DIRC2 Polyclonal Antibody for WB, ELISA

Cat No. 26750-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

RCC4, SLC49A4, Solute carrier family 49 member 4

• 

  WB analysis of MCF-7 using 26750-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26750-1-AP (DIRC2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 26750-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 26750-1-AP (DIRC2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DIRC2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26750-1-AP targets DIRC2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24687

  Product name: Recombinant human DIRC2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 180-281 aa of BC039821

  Sequence: ATATAIASMLSYLGGACAFLVGPLVVPAPNGTSPLLAAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQRLSYRRSVCRLLSNFR

• Full Name: disrupted in renal carcinoma 2
• Calculated Molecular Weight: 478 aa, 52 kDa
• Observed Molecular Weight: 48-52 kDa
• GenBank Accession Number: BC039821
• Gene Symbol: DIRC2
• Gene ID (NCBI): 84925
• RRID: AB_2880621
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96SL1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DIRC2 Polyclonal antibody (Cat# 26750-1-AP) has 1 citation. It was used in a study published in PeerJ (2024) investigating immune infiltration-related gene signatures for coronary artery disease. The research field is cardiovascular disease, specifically focusing on identifying novel gene signatures associated with immune cell infiltration in coronary artery disease. The antibody was applied in Western blot (WB) with human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	PeerJ; Identification of a novel immune infiltration-related gene signature, MCEMP1, for coronary artery disease; Authors - Wei Ye