DIS3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DIS3 Polyclonal antibody, PBS Only (29664-1-PBS)

• 

  WB analysis using 29664-1-AP (same clone as 29664-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29664-1-AP (DIS3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29664-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29664-1-AP (same clone as 29664-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29664-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 29664-1-AP (same clone as 29664-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29664-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 29664-1-AP (same clone as 29664-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29664-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 29664-1-AP (same clone as 29664-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29664-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29664-1-AP (same clone as 29664-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29664-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29664-1-AP (same clone as 29664-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29664-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 29664-1-AP (same clone as 29664-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29664-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 29664-1-AP (same clone as 29664-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29664-1-AP (DIS3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29664-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 29664-1-AP (same clone as 29664-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DIS3 antibody (29664-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidine (red). This data was developed using the same antibody clone with 29664-1-PBS in a different storage buffer formulation.

DIS3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29664-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DIS 3, Dis-3, dis3p, EC:3.1.13.-, EXOSC11

---

Product Information

29664-1-PBS targets DIS3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31711

  Product name: Recombinant human DIS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 607-958 aa of NM_014953

  Sequence: TTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHMDSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPELTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKLGK

• Full Name: DIS3 mitotic control homolog (S. cerevisiae)
• Calculated Molecular Weight: 109KD
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: NM_014953
• Gene Symbol: DIS3
• Gene ID (NCBI): 22894
• RRID: AB_2918336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2L1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DIS3, also named as KIAA1008 and RRP44, belongs to the ribonuclease II (RNB) family. It is a component of the exosome 3'->5' exoribonuclease complex. DIS3 is required for the 3'-processing of the 7S pre-RNA to the mature nuclear complex. It is also associated with the GTPase Ran. DIS3 has a 3'-5' exonuclease activity.