DIS3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85705-2-RR (same clone as 85705-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85705-2-RR (DIS3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85705-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 85705-2-RR (same clone as 85705-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85705-2-RR (DIS3 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85705-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 85705-2-RR (same clone as 85705-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85705-2-RR (DIS3 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85705-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85705-2-RR (same clone as 85705-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DIS3 antibody (85705-2-RR, Clone: 242934G8 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85705-2-PBS in a different storage buffer formulation.

DIS3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 85705-2-PBS

Clone No.242934G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DIS 3, Dis-3, dis3p, EC:3.1.13.-, EXOSC11

---

Product Information

85705-2-PBS targets DIS3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31725

  Product name: Recombinant human DIS3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 607-958 aa of NM_014953

  Sequence: TTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHMDSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPELTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKLGK

• Full Name: DIS3 mitotic control homolog (S. cerevisiae)
• Calculated Molecular Weight: 109KD
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: NM_014953
• Gene Symbol: DIS3
• Gene ID (NCBI): 22894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y2L1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DIS3, also named as KIAA1008 and RRP44, belongs to the ribonuclease II (RNB) family. It is a component of the exosome 3'->5' exoribonuclease complex. DIS3 is required for the 3'-processing of the 7S pre-RNA to the mature nuclear complex. It is also associated with the GTPase Ran. DIS3 has a 3'-5' exonuclease activity.