DIS3 Recombinant monoclonal antibody

• 

  WB analysis using 85705-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85705-2-RR (DIS3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 85705-2-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85705-2-RR (DIS3 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 85705-2-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85705-2-RR (DIS3 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 85705-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DIS3 antibody (85705-2-RR, Clone: 242934G8 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

DIS3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85705-2-RR

Clone No.242934G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DIS 3, Dis-3, dis3p, EC:3.1.13.-, EXOSC11

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells, Jurkat cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85705-2-RR targets DIS3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31725

  Product name: Recombinant human DIS3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 607-958 aa of NM_014953

  Sequence: TTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHMDSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPELTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKLGK

• Full Name: DIS3 mitotic control homolog (S. cerevisiae)
• Calculated Molecular Weight: 109KD
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: NM_014953
• Gene Symbol: DIS3
• Gene ID (NCBI): 22894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y2L1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.