DKK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DKK2 Polyclonal antibody, PBS Only (29023-1-PBS)

• 

  WB analysis using 29023-1-AP (same clone as 29023-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29023-1-AP (DKK2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29023-1-PBS in a different storage buffer formulation.

DKK2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29023-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

29023-1-PBS targets DKK2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30596

  Product name: Recombinant human DKK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-183 aa of BC075078

  Sequence: KLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPC

• Full Name: dickkopf homolog 2 (Xenopus laevis)
• Calculated Molecular Weight: 259 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC075078
• Gene Symbol: DKK2
• Gene ID (NCBI): 27123
• RRID: AB_3086095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBU2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.