DLC1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66894-1-Ig (same clone as 66894-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66894-1-Ig (DLC1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66894-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66894-1-Ig (same clone as 66894-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66894-1-Ig (DLC1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66894-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A375 using 66894-1-Ig (same clone as 66894-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A375 cells using DLC1 antibody (66894-1-Ig, Clone: 1G10H12 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66894-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66894-1-Ig (same clone as 66894-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using DLC1 antibody (66894-1-Ig, Clone: 1G10H12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66894-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66894-1-Ig (same clone as 66894-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using DLC1 antibody (66894-1-Ig, Clone: 1G10H12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66894-1-PBS in a different storage buffer formulation.

DLC1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66894-1-PBS

Clone No.1G10H12

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ARHGAP7, deleted in liver cancer 1, DLC 1, DLC1, FLJ21120, HP, HP protein, KIAA1723, p122 RhoGAP, STARD12

---

Product Information

66894-1-PBS targets DLC1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24404

  Product name: Recombinant human DLC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 111-370 aa of BC054511

  Sequence: SDEDNNADLCLTDDKQVLNTQGQKTSGQHMIQGAGSLEKALPIIQSNQVSSNSWGIAGETELALVKESGERKVTDSISKSLELCNEISLSEIKDAPKVNAVDTLNVKDIAPEKQLLNSAVIAQQRRKPDPPKDENERSTCNVVQDEFLDTPCTNRGLPLLKTDFGSCLLQPPSCPNGMSAENGLEKSGFSQHQNKSPPKVKAEDGMQCLQLKETLATQEPTDNQVRLRKRKEIREDRDRARLDSMVLLIMKLDQLDQDIE

• Full Name: deleted in liver cancer 1
• Calculated Molecular Weight: 171 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC054511
• Gene Symbol: DLC1
• Gene ID (NCBI): 10395
• RRID: AB_2882223
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96QB1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Deleted in Liver Cancer 1 (DLC1) is a RhoGAP-containing tumor suppressor that inhibits angiogenesis by repressing VEGF production in epithelial cells. DLC1 is often down-regulated in a variety of cancers, such as those of the liver, lung, breast, stomach, brain, colon and prostate due to either genomic deletion or aberrant DNA methylation.