DLD Monoclonal antibody, PBS Only

• 

  WB analysis using 67702-1-Ig (same clone as 67702-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67702-1-Ig (DLD antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67702-1-Ig (same clone as 67702-1-PBS)

  WB result of DLD antibody (67702-1-Ig; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DLD transfected HeLa cells. This data was developed using the same antibody clone with 67702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67702-1-Ig (same clone as 67702-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67702-1-Ig (DLD antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67702-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67702-1-Ig (same clone as 67702-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67702-1-Ig (DLD antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67702-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67702-1-Ig (same clone as 67702-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67702-1-Ig (DLD antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67702-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67702-1-Ig (same clone as 67702-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67702-1-Ig (DLD antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67702-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DLD Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67702-1-PBS

Clone No.2E7G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

2E7G5, DLDH, EC:1.8.1.4, GCSL, LAD

---

Product Information

67702-1-PBS targets DLD in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9680

  Product name: Recombinant human DLD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 160-509 aa of BC018696

  Sequence: NQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

• Full Name: dihydrolipoamide dehydrogenase
• Calculated Molecular Weight: 509 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC018696
• Gene Symbol: DLD
• Gene ID (NCBI): 1738
• RRID: AB_2882894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P09622
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DLD(Dihydrolipoyl dehydrogenase, mitochondrial) is also named as GCSL, LAD, PHE3 and belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It catalyzes the oxidation of dihydrolipoamide, hE3 uses two molecules : non-covalently bound FAD and a transiently bound substrate, NAD+. DLD is involved in the hyperactivation of spermatazoa during capacitation and in the spermatazoal acrosome reaction.