• Featured Product
  • KD/KO Validated

DLD Monoclonal antibody

DLD Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67702-1-Ig
Clone No.2E7G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

2E7G5, DLDH, EC:1.8.1.4, GCSL, LAD

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHuH-7 cells, NIH/3T3 cells, HSC-T6 cells, HeLa cells, L02 cells, HepG2 cells, Jurkat cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

67702-1-Ig targets DLD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9680

Product name: Recombinant human DLD protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 160-509 aa of BC018696

Sequence: NQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Predict reactive species
Full Name dihydrolipoamide dehydrogenase
Calculated Molecular Weight 509 aa, 54 kDa
Observed Molecular Weight54 kDa
GenBank Accession NumberBC018696
Gene Symbol DLD
Gene ID (NCBI) 1738
RRIDAB_2882894
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP09622
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLD(Dihydrolipoyl dehydrogenase, mitochondrial) is also named as GCSL, LAD, PHE3 and belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It catalyzes the oxidation of dihydrolipoamide, hE3 uses two molecules : non-covalently bound FAD and a transiently bound substrate, NAD+. DLD is involved in the hyperactivation of spermatazoa during capacitation and in the spermatazoal acrosome reaction.

Protocols

Product Specific Protocols
IHC protocol for DLD antibody 67702-1-IgDownload protocol
WB protocol for DLD antibody 67702-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Front Immunol

The signature of cuproptosis-related immune genes predicts the tumor microenvironment and prognosis of prostate adenocarcinoma

Authors - Kai Yao
Loading...
||
New chat Able
正在加载,请稍候...