DLGAP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DLGAP1 Polyclonal antibody, PBS Only (28124-1-PBS)

• 

  WB analysis using 28124-1-AP (same clone as 28124-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28124-1-AP (DLGAP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28124-1-PBS in a different storage buffer formulation.

DLGAP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28124-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

28124-1-PBS targets DLGAP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27182

  Product name: Recombinant human DLGAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 10-68 aa of BC070175

  Sequence: HHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASS

• Full Name: discs, large (Drosophila) homolog-associated protein 1
• Calculated Molecular Weight: 543 aa, 60 kDa
• Observed Molecular Weight: 110-130 kDa
• GenBank Accession Number: BC070175
• Gene Symbol: DLGAP1
• Gene ID (NCBI): 9229
• RRID: AB_3086030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14490
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.