Use Able AI chat for product recommendations

DLL3 Polyclonal antibody

DLL3 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 25535-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

delta like 3 (Drosophila), Delta like protein 3, Delta3, Delta-like protein 3, Drosophila Delta homolog 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat brain tissue
Positive IHC detected inhuman liver tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25535-1-AP targets DLL3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21965

Product name: Recombinant human DLL3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 241-472 aa of BC000218

Sequence: EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDG

Predict reactive species
Full Name delta-like 3 (Drosophila)
Calculated Molecular Weight 65 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC000218
Gene Symbol DLL3
Gene ID (NCBI) 10683
RRIDAB_2880122
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NYJ7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Delta-Notch pathway is an evolutionarily conserved signaling pathway which controls a broad range of developmental processes including cell fate determination, terminal differentiation and proliferation (PMID: 22353464). In mammals, four Notch receptors (NOTCH1-4) and five activating canonical ligands (JAGGED1, JAGGED2, DLL1, DLL3 and DLL4) have been described (PMID: 22353464). DLL3 is an inhibitory ligand of the Notch signaling pathway that is predominantly localizes to the Golgi apparatus (PMID: 17664336) in normal condition. Normal tissue expression of DLL3 is highest in fetal brain, and DLL3 plays a key role in somitogenesis in the paraxial mesoderm (PMID: 26311731). It has been reported that DLL3 is expressed on the surface of tumor cells of small cell lung cancer (SCLC) and high-grade neuroendocrine carcinomas (LCNEC) and has emerged as a novel therapeutic target (PMID: 26311731; 28487384).

Protocols

Product Specific Protocols
IF protocol for DLL3 antibody 25535-1-APDownload protocol
IHC protocol for DLL3 antibody 25535-1-APDownload protocol
WB protocol for DLL3 antibody 25535-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Transl Oncol

High expression of DLL3 is associated with a poor prognosis and immune infiltration in invasive breast cancer patients.

Authors - Chong Yuan
humanWB

J Immunother Cancer

Combined DLL3-targeted bispecific antibody with PD-1 inhibition is efficient to suppress small cell lung cancer growth.

Authors - Xin Chen
humanIHC

Technol Cancer Res Treat

Investigation of Candidate Genes and Pathways in Basal/TNBC Patients by Integrated Analysis.

Authors - Qi Liu
human, mouse, ratWB

J Adv Res

Trained immunity-primed DLL3-targeted CAR macrophages for the eradication of small cell lung cancer.

Authors - Hangjie Ying
Loading...
||
New chat

Able

正在加载,请稍候...