CoraLite® Plus 647-conjugated DLL3 Polyclonal antibody

DLL3 Polyclonal Antibody for IF-P
Cat No. CL647-25535

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

delta like 3 (Drosophila), Delta like protein 3, Delta3, Delta-like protein 3, Drosophila Delta homolog 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-25535 targets DLL3 in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21965

Product name: Recombinant human DLL3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 241-472 aa of BC000218

Sequence: EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDG

Predict reactive species
Full Name delta-like 3 (Drosophila)
Calculated Molecular Weight 65 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC000218
Gene Symbol DLL3
Gene ID (NCBI) 10683
RRIDAB_3084804
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NYJ7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The Delta-Notch pathway is an evolutionarily conserved signaling pathway which controls a broad range of developmental processes including cell fate determination, terminal differentiation and proliferation (PMID: 22353464). In mammals, four Notch receptors (NOTCH1-4) and five activating canonical ligands (JAGGED1, JAGGED2, DLL1, DLL3 and DLL4) have been described (PMID: 22353464). DLL3 is an inhibitory ligand of the Notch signaling pathway that is predominantly localizes to the Golgi apparatus (PMID: 17664336) in normal condition. Normal tissue expression of DLL3 is highest in fetal brain, and DLL3 plays a key role in somitogenesis in the paraxial mesoderm (PMID: 26311731). It has been reported that DLL3 is expressed on the surface of tumor cells of small cell lung cancer (SCLC) and high-grade neuroendocrine carcinomas (LCNEC) and has emerged as a novel therapeutic target (PMID: 26311731; 28487384).

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 DLL3 antibody CL647-25535Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...