DLL4 Polyclonal antibody

• 

  WB analysis using 32331-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32331-1-AP (DLL4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 32331-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32331-1-AP (DLL4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

DLL4 Polyclonal Antibody for WB, ELISA

Cat No. 32331-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

UNQ1895/PRO4341, hdelta2, Delta4

---

Tested Applications

• Positive WB detected in: A431 cells, mouse brain tissue, mouse kidney tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32331-1-AP targets DLL4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34664

  Product name: Recombinant human DLL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-275 aa of BC106950

  Sequence: EAWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEG

• Full Name: delta-like 4 (Drosophila)
• Calculated Molecular Weight: 685 aa, 75 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC106950
• Gene Symbol: DLL4
• Gene ID (NCBI): 54567
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR61
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLL4, also named as Delta4, plays a role in the Notch signaling pathway. It activates Notch-1 and Notch-4. Notch signaling is activated upon engagement of the Notch receptor with its ligands, the DSL (Delta, Serrate, Lag2) proteins of single-pass type I membrane proteins. DLL4 is highly expressed in the vascular endothelium and is involved in angiogenesis.