DLST Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DLST Polyclonal antibody, PBS Only (31174-1-PBS)

• 

  WB analysis using 31174-1-AP (same clone as 31174-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31174-1-AP (DLST antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31174-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 31174-1-AP (same clone as 31174-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31174-1-AP (DLST antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31174-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 31174-1-AP (same clone as 31174-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31174-1-AP (DLST antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31174-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31174-1-AP (same clone as 31174-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using DLST antibody (31174-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31174-1-PBS in a different storage buffer formulation.

DLST Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31174-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DLTS, OGDC E2

---

Product Information

31174-1-PBS targets DLST in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34753

  Product name: Recombinant human DLST protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 212-366 aa of BC001922

  Sequence: EPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDG

• Full Name: dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 40 kDa, 49 kDa
• GenBank Accession Number: BC001922
• Gene Symbol: DLST
• Gene ID (NCBI): 1743
• RRID: AB_3742403
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P36957
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DLST (Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex) ) is the E2 transferase of α-ketoglutarate dehydrogenase complex (KGDHC) that regulates the irreversible conversion of α-ketoglutarate to succinyl-CoA in the TCA cycle.RNAi knockdown of DLST led to decreased cell viability and induction of apoptosis in human T-ALL cell lines. High DLST expression predicts poor overall and recurrencefree survival among TNBC patients (PMID: 26876595, 34785772). DLST has two isoforms of 40 kDa, 49 kDa.