DLX3 Polyclonal antibody

• 

  WB analysis using 13261-3-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13261-3-AP (DLX3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 13261-3-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13261-3-AP (DLX3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 13261-3-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 13261-3-AP (DLX3 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human lung cancer using 13261-3-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 13261-3-AP (DLX3 antibody) at dilution of 1:100 (under 40x lens).

DLX3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13261-3-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

AI4, distal less homeobox 3, DLX3, Homeobox protein DLX 3, TDO

---

Tested Applications

• Positive WB detected in: JAR cells, mouse lung tissue, NCCIT cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 2 publications below

Product Information

13261-3-AP targets DLX3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3865

  Product name: Recombinant human DLX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-287 aa of BC028970

  Sequence: MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY

• Full Name: distal-less homeobox 3
• Calculated Molecular Weight: 287 aa, 32 kDa
• Observed Molecular Weight: 32-38 kDa
• GenBank Accession Number: BC028970
• Gene Symbol: DLX3
• Gene ID (NCBI): 1747
• RRID: AB_2292996
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60479
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Distal-less homeobox 3 (DLX3), a member of the Dlx family, plays a crucial role in epithelium, hair, bone, tooth and placental development. DLX3 is expressed during the calcium (Ca2+)-dependent epidermal differentiation process. The calculated molecular weight of DLX3 is 32 kDa. This antibody detects the 32-38 kDa protein in SDS-PAGE. (PMID: 31029881)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP,CoIP,IF	J Biol Chem; New insights into the regulation of placental growth factor gene expression by the transcription factors GCM1 and DLX3 in human placenta.; Authors - Yueh-Ho Chiu
mouse	WB,CoIP	Stem Cells; IPO7 promotes odontoblastic differentiation and inhibits osteoblastic differentiation through regulation of RUNX2 expression and translocation; Authors - Yue Zhang
human	WB	Exp Mol Med; METTL3-mediated pre-miR-665/DLX3 m6A methylation facilitates the committed differentiation of stem cells from apical papilla; Authors - Tingjie Gu ; KD Validated