DLX3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DLX3 Polyclonal antibody, PBS Only (13261-3-PBS)

• 

  WB analysis using 13261-3-AP (same clone as 13261-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13261-3-AP (DLX3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13261-3-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 13261-3-AP (same clone as 13261-3-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13261-3-AP (DLX3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13261-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 13261-3-AP (same clone as 13261-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 13261-3-AP (DLX3 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13261-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 13261-3-AP (same clone as 13261-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 13261-3-AP (DLX3 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13261-3-PBS in a different storage buffer formulation.

DLX3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13261-3-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

13261-3-PBS targets DLX3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3865

  Product name: Recombinant human DLX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-287 aa of BC028970

  Sequence: MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY

• Full Name: distal-less homeobox 3
• Calculated Molecular Weight: 287 aa, 32 kDa
• Observed Molecular Weight: 32-38 kDa
• GenBank Accession Number: BC028970
• Gene Symbol: DLX3
• Gene ID (NCBI): 1747
• RRID: AB_2292996
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60479
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Distal-less homeobox 3 (DLX3), a member of the Dlx family, plays a crucial role in epithelium, hair, bone, tooth and placental development. DLX3 is expressed during the calcium (Ca2+)-dependent epidermal differentiation process. The calculated molecular weight of DLX3 is 32 kDa. This antibody detects the 32-38 kDa protein in SDS-PAGE. (PMID: 31029881)