DLX6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DLX6 Polyclonal antibody, PBS Only (23216-1-PBS)

• 

  WB analysis of NCCIT using 23216-1-AP (same clone as 23216-1-PBS)

  NCCIT cell were subjected to SDS PAGE followed by western blot with 23216-1-AP (DLX6 Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23216-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 23216-1-AP (same clone as 23216-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 23216-1-AP (DLX6 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23216-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 23216-1-AP (same clone as 23216-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 23216-1-AP (DLX6 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23216-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 23216-1-AP (same clone as 23216-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 23216-1-AP (DLX6 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23216-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DLX6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 23216-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Homeobox protein DLX-6

---

Product Information

23216-1-PBS targets DLX6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19724

  Product name: Recombinant human DLX6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-175 aa of BC069363

  Sequence: QGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM

• Full Name: distal-less homeobox 6
• Calculated Molecular Weight: 175 aa, 20 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC069363
• Gene Symbol: DLX6
• Gene ID (NCBI): 1750
• RRID: AB_2879233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56179
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.