DLX6 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85946-1-RR (same clone as 85946-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85946-1-RR (DLX6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85946-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 85946-1-RR (same clone as 85946-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 85946-1-RR (DLX6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85946-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 85946-1-RR (same clone as 85946-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 85946-1-RR (DLX6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85946-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85946-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85946-1-RR against Human DLX6 were performed. The affinity constant is 5.65 nM.

DLX6 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85946-1-PBS

Clone No.250408B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Homeobox protein DLX-6

---

Product Information

85946-1-PBS targets DLX6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19724

  Product name: Recombinant human DLX6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-175 aa of BC069363

  Sequence: QGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM

• Full Name: distal-less homeobox 6
• Calculated Molecular Weight: 175 aa, 20 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC069363
• Gene Symbol: DLX6
• Gene ID (NCBI): 1750
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56179
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Distal-less homeobox 6 (DLX6) has been reported to play important roles in the development of craniofacial structures, inner ear, limb, and brain. DLX6 was significantly highly expressed in oral cancer tissues in The Cancer Genome Atlas database. DLX6 promotes cell proliferation and suppresses cell apoptosis in oral cancer cells. EGFR-CCND1 pathway might be the potential mechanism participating in the regulating axis (PMID: 33215805).