DMC1 Monoclonal antibody

• 

  WB analysis of HeLa using 67176-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67176-1-Ig (DMC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 67176-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67176-1-Ig (DMC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67176-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67176-1-Ig (DMC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 67176-1-Ig

  IP result of anti-DMC1 (IP:67176-1-Ig, 4ug; Detection:67176-1-Ig 1:1000) with mouse testis tissue lysate 2040 ug.

• 

  IHC staining of mouse testis using 67176-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67176-1-Ig (DMC1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 67176-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67176-1-Ig (DMC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 67176-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using DMC1 antibody (67176-1-Ig, Clone: 2D5C9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). DAPI (blue).

• 

  IF Staining of mouse testis using 67176-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using DMC1 antibody (67176-1-Ig, Clone: 2D5C9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). DAPI (blue).

DMC1 Monoclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 67176-1-Ig

Clone No.2D5C9

Publications(2)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

LIM15, HsLim15, DMC1H, 2D5C9

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, human testis tissue, rat testis, mouse testis
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 2 publications below

Product Information

67176-1-Ig targets DMC1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6951

  Product name: Recombinant human DMC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-165 aa of BC035658

  Sequence: MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTL

• Full Name: DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
• Calculated Molecular Weight: 165 aa, 18 kDa, 38 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC035658
• Gene Symbol: DMC1
• Gene ID (NCBI): 11144
• RRID: AB_2882472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14565
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	J Genet Genomics; The novel male meiosis recombination regulator coordinates the progression of meiosis prophase I.; Authors - Miao Li
mouse	IF	Elife; ARID1A governs the silencing of sex-linked transcription during male meiosis in the mouse; Authors - Debashish U Menon