DMC1 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 67176-1-Ig (same clone as 67176-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67176-1-Ig (DMC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67176-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67176-1-Ig (same clone as 67176-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67176-1-Ig (DMC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67176-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67176-1-Ig (same clone as 67176-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67176-1-Ig (DMC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67176-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 67176-1-Ig (same clone as 67176-1-PBS)

  IP result of anti-DMC1 (IP:67176-1-Ig, 4ug; Detection:67176-1-Ig 1:1000) with mouse testis tissue lysate 2040 ug. This data was developed using the same antibody clone with 67176-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67176-1-Ig (same clone as 67176-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67176-1-Ig (DMC1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67176-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67176-1-Ig (same clone as 67176-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67176-1-Ig (DMC1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67176-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 67176-1-Ig (same clone as 67176-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using DMC1 antibody (67176-1-Ig, Clone: 2D5C9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). DAPI (blue). This data was developed using the same antibody clone with 67176-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 67176-1-Ig (same clone as 67176-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using DMC1 antibody (67176-1-Ig, Clone: 2D5C9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). DAPI (blue). This data was developed using the same antibody clone with 67176-1-PBS in a different storage buffer formulation.

DMC1 Monoclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 67176-1-PBS

Clone No.2D5C9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

LIM15, HsLim15, DMC1H, 2D5C9

---

Product Information

67176-1-PBS targets DMC1 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6951

  Product name: Recombinant human DMC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-165 aa of BC035658

  Sequence: MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTL

• Full Name: DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
• Calculated Molecular Weight: 165 aa, 18 kDa, 38 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC035658
• Gene Symbol: DMC1
• Gene ID (NCBI): 11144
• RRID: AB_2882472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14565
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.