DNAH17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DNAH17 Polyclonal antibody, PBS Only (24488-1-PBS)

• 

  WB analysis using 24488-1-AP (same clone as 24488-1-PBS)

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 24488-1-AP (DNAH17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24488-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 24488-1-AP (same clone as 24488-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24488-1-AP (DNAH17 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24488-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 24488-1-AP (same clone as 24488-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24488-1-AP (DNAH17 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24488-1-PBS in a different storage buffer formulation.

DNAH17 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24488-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

DNAHL1, DNEL2

---

Product Information

24488-1-PBS targets DNAH17 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20033

  Product name: Recombinant human DNAH17 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 299-644 aa of BC112284

  Sequence: MEQADFTMLPTFIAKVLDTICFIWATSEYYNTPARIIVILQEFCNQIIEMTRTFLSPEEVLKGLQGEIEEVLSGISLAVNVLKELYQTYDFCCVNMKLFFKDKEPVPWEFPSSLAFSRINSFFQRIQTIEELYKTAIEFLKLEKIELGGVRGNLLGSLVTRIYDEVFELVKVFADCKYDPLDPGDSNFDRDYADFEIKIQDLDRRLATIFCQGFDDCSCIKSSAKLLYMCGGLMERPLILAEVAPRYSVMLELFDAELDNAKILYDAQMAASEEGNIPLIHKNMPPVAGQLKWSLELQERLEVSMKHLKHVEHPVMSGAEAKLTYQKYDEMMELLRCHREKIYQQW

• Full Name: dynein, axonemal, heavy chain 17
• Calculated Molecular Weight: 4485 aa, 512 kDa
• Observed Molecular Weight: 500-512 kDa
• GenBank Accession Number: BC112284
• Gene Symbol: DNAH17
• Gene ID (NCBI): 8632
• RRID: AB_2879568
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UFH2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.