DNAJB1 Recombinant monoclonal antibody

• 

  WB analysis using 82676-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82676-1-RR (DNAJB1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse lung using 82676-1-RR

  IP result of anti-DNAJB1 (IP:82676-1-RR, 4ug; Detection:82676-1-RR 1:5000) with mouse lung tissue lysate 1120 ug.

• 

  IHC staining of human colon cancer using 82676-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 82676-1-RR (DNAJB1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 82676-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 82676-1-RR (DNAJB1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 82676-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DNAJB1 antibody (82676-1-RR, Clone: 4K3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• 

  Affinity and Kinetic Characterization of 82676-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82676-1-RR against Human DNAJB1 were performed. The affinity constant is 0.213 nM.

DNAJB1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 82676-1-RR

Clone No.4K3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

hDj-1, Hdj1, hDj 1, DNAJ1, DnaJ protein homolog 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, C2C12 cells, C6 cells, mouse liver tissue, rat liver tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82676-1-RR targets DNAJB1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3830

  Product name: Recombinant human DNAJB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-340 aa of BC019827

  Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

• Full Name: DnaJ (Hsp40) homolog, subfamily B, member 1
• Calculated Molecular Weight: 340 aa, 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC019827
• Gene Symbol: DNAJB1
• Gene ID (NCBI): 3337
• RRID: AB_3086502
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P25685
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNAJB1 is a member of the heat shock 40 protein family and has been involved in a variety of cellular processes, including the proteasome pathway, endoplasmic reticulum stress and viral infection. DNAJB1-PRKACA gene fusions have been considered diagnostic for fibrolamellar hepatocellular carcinoma.