CoraLite® Plus 488-conjugated DNAJB1 Recombinant monoclonal antibody

DNAJB1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-82676
Clone No.4K3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

4K3, DnaJ protein homolog 1, DNAJ1, hDj 1, Hdj1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82676 targets DNAJB1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3830

Product name: Recombinant human DNAJB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-340 aa of BC019827

Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

Predict reactive species
Full Name DnaJ (Hsp40) homolog, subfamily B, member 1
Calculated Molecular Weight 340 aa, 40 kDa
Observed Molecular Weight 37-40 kDa
GenBank Accession NumberBC019827
Gene Symbol DNAJB1
Gene ID (NCBI) 3337
RRIDAB_3084518
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP25685
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DNAJB1 is a member of the heat shock 40 protein family and has been involved in a variety of cellular processes, including the proteasome pathway, endoplasmic reticulum stress and viral infection. DNAJB1-PRKACA gene fusions have been considered diagnostic for fibrolamellar hepatocellular carcinoma.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 DNAJB1 antibody CL488-82676Download protocol
IF protocol for CL Plus 488 DNAJB1 antibody CL488-82676Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...