Biotin-conjugated DNAJB12 Polyclonal antibody

• 

  IHC staining of human colon cancer using Biotin-16780

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using Biotin-16780 (DNAJB12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using Biotin-16780

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using Biotin-16780 (DNAJB12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

DNAJB12 Polyclonal Antibody for IHC

Cat No. Biotin-16780

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC

Synonyms

DJ10, DKFZp586B2023, DNAJB12

---

Tested Applications

• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-16780 targets DNAJB12 in IHC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10193

  Product name: Recombinant human DNAJB12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-248 aa of BC011812

  Sequence: AYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLHG

• Full Name: DnaJ (Hsp40) homolog, subfamily B, member 12
• Calculated Molecular Weight: 375 aa, 42 kDa
• Observed Molecular Weight: 40-42 kDa
• GenBank Accession Number: BC011812
• Gene Symbol: DNAJB12
• Gene ID (NCBI): 54788
• RRID: AB_2934329
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXW2
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DNAJB12 (JB12), a ER transmembrane chaperone, specifically interacts with Hsc70 to facilitate ER retention and delivery of membrane proteins for folding or degradation in the ERAD pathway. Hsc70 chaperone activities require the substrate targeting function of DNAJB12. DNAJB12 recruits specific substrates to contact Hsc70 and then stimulates its ATPase activity. (PMID: 34668642)