DNAJB9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DNAJB9 Polyclonal antibody, PBS Only (13157-1-PBS)

• 

  WB analysis using 13157-1-AP (same clone as 13157-1-PBS)

  Mouse kidney lysates were subjected to SDS PAGE followed by western blot with 13157-1-AP (DNAJB9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13157-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 13157-1-AP (same clone as 13157-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13157-1-AP (DNAJB9 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 13157-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 13157-1-AP (same clone as 13157-1-PBS)

  IP result of anti-DNAJB9 (IP:13157-1-AP, 4ug; Detection:13157-1-AP 1:500) with mouse testis tissue lysate 4800ug. This data was developed using the same antibody clone with 13157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13157-1-AP (same clone as 13157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13157-1-AP (DNAJB9 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13157-1-AP (same clone as 13157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13157-1-AP (DNAJB9 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13157-1-AP (same clone as 13157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13157-1-AP (DNAJB9 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 13157-1-AP (same clone as 13157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13157-1-AP (DNAJB9 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13157-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DNAJB9 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13157-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

13157-1-PBS targets DNAJB9 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3789

  Product name: Recombinant human DNAJB9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-223 aa of BC028912

  Sequence: SYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ

• Full Name: DnaJ (Hsp40) homolog, subfamily B, member 9
• Calculated Molecular Weight: 223 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC028912
• Gene Symbol: DNAJB9
• Gene ID (NCBI): 4189
• RRID: AB_2877918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBS3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.