DNAJC18 Polyclonal antibody

• 

  WB analysis using 25162-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25162-1-AP (DNAJC18 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 25162-1-AP

  WB result of DNAJC18 antibody (25162-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DNAJC18 transfected A431 cells.

• 

  WB analysis using 25162-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25162-1-AP (DNAJC18 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 25162-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25162-1-AP (DNAJC18 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 25162-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25162-1-AP (DNAJC18 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 25162-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using DNAJC18 antibody (25162-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of U2OS using 25162-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using 25162-1-AP (DNAJC18 antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

DNAJC18 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25162-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DNAJC 18

---

Tested Applications

• Positive WB detected in: HEK-293 cells, A431 cells, HepG2 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25162-1-AP targets DNAJC18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18498

  Product name: Recombinant human DNAJC18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 196-358 aa of BC030162

  Sequence: TDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVIISVITQLLATNPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKLIGLRRGG

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 18
• Calculated Molecular Weight: 358 aa, 42 kDa
• Observed Molecular Weight: 39-42 kDa
• GenBank Accession Number: BC030162
• Gene Symbol: DNAJC18
• Gene ID (NCBI): 202052
• RRID: AB_2918087
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H819
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DnaJC18, also named as DnaJ (Hsp40) homolog, subfamily C, member 21, belongs to Type III DnaJ Family. Type III DnaJ proteins have a J domain but lack the other sequence features that are found in type I and II members of the family. DnaJC18 might play a role in the process of spermatogenesis in adult testis (PMID: 29082339).