DNAJC18 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DNAJC18 Polyclonal antibody, PBS Only (25162-1-PBS)

• 

  WB analysis of A431 using 25162-1-AP (same clone as 25162-1-PBS)

  WB result of DNAJC18 antibody (25162-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DNAJC18 transfected A431 cells. This data was developed using the same antibody clone with 25162-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25162-1-AP (same clone as 25162-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25162-1-AP (DNAJC18 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25162-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25162-1-AP (same clone as 25162-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25162-1-AP (DNAJC18 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25162-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 25162-1-AP (same clone as 25162-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25162-1-AP (DNAJC18 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25162-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 25162-1-AP (same clone as 25162-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25162-1-AP (DNAJC18 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25162-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 25162-1-AP (same clone as 25162-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using DNAJC18 antibody (25162-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25162-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 25162-1-AP (same clone as 25162-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using 25162-1-AP (DNAJC18 antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25162-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DNAJC18 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25162-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DNAJC 18

---

Product Information

25162-1-PBS targets DNAJC18 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18498

  Product name: Recombinant human DNAJC18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 196-358 aa of BC030162

  Sequence: TDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVIISVITQLLATNPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKLIGLRRGG

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 18
• Calculated Molecular Weight: 358 aa, 42 kDa
• Observed Molecular Weight: 39-42 kDa
• GenBank Accession Number: BC030162
• Gene Symbol: DNAJC18
• Gene ID (NCBI): 202052
• RRID: AB_2918087
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H819
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DnaJC18, also named as DnaJ (Hsp40) homolog, subfamily C, member 21, belongs to Type III DnaJ Family. Type III DnaJ proteins have a J domain but lack the other sequence features that are found in type I and II members of the family. DnaJC18 might play a role in the process of spermatogenesis in adult testis (PMID: 29082339).