DNAJC19 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DNAJC19 Polyclonal antibody, PBS Only (12096-1-PBS)

• 

  WB analysis of HeLa using 12096-1-AP (same clone as 12096-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12096-1-AP (DNAJC19 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12096-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12096-1-AP (same clone as 12096-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12096-1-AP (DNAJC19 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12096-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12096-1-AP (same clone as 12096-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12096-1-AP (DNAJC19 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12096-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human lung using 12096-1-AP (same clone as 12096-1-PBS)

  human lung tissue were subjected to SDS PAGE followed by western blot with 12096-1-AP (DNAJC19 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12096-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 12096-1-AP (same clone as 12096-1-PBS)

  IP result of anti-DNAJC19 (IP:12096-1-AP, 4ug; Detection:12096-1-AP 1:1000) with mouse heart tissue lysate 4000ug. This data was developed using the same antibody clone with 12096-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 12096-1-AP (same clone as 12096-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using DNAJC19 antibody (12096-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12096-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DNAJC19 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 12096-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

12096-1-PBS targets DNAJC19 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2739

  Product name: Recombinant human DNAJC19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-116 aa of BC009702

  Sequence: MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 19
• Calculated Molecular Weight: 116 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC009702
• Gene Symbol: DNAJC19
• Gene ID (NCBI): 131118
• RRID: AB_2094914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96DA6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNAJC19 is a mitochondrial cochaperone that interacts with HSP70 chaperones through its conserved J-domain. As a transmembrane protein, DNAJC19 is strongly associated with the inner mitochondrial membrane. Mutations in DNAJC19 cause dilated cardiomyopathy with ataxia (DCMA). Recently DNAJC19 has been reported as interactor of PHB complex to regulate cardiolipin remodeling, which addressed the link of DNAJC19 to cardiomyopathy. This antibody is specific to DNAJC19 and had been tested by siRNA.(24856930)