DNAJC6/AUXILIN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DNAJC6/AUXILIN Polyclonal antibody, PBS Only (21941-1-PBS)

• 

  WB analysis using 21941-1-AP (same clone as 21941-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21941-1-AP (DNAJC6/AUXILIN antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21941-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 21941-1-AP (same clone as 21941-1-PBS)

  IP result of anti-DNAJC6/AUXILIN (IP:21941-1-AP, 4ug; Detection:21941-1-AP 1:2000) with mouse brain tissue lysate 4000 ug. This data was developed using the same antibody clone with 21941-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 21941-1-AP (same clone as 21941-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21941-1-AP (DNAJC6/AUXILIN antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21941-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 21941-1-AP (same clone as 21941-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21941-1-AP (DNAJC6/AUXILIN antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21941-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21941-1-AP (same clone as 21941-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using DNAJC6/AUXILIN antibody (21941-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21941-1-PBS in a different storage buffer formulation.

DNAJC6/AUXILIN Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 21941-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Auxilin, DNAJC6, DJC6, EC:3.1.3.-, KIAA0473

---

Product Information

21941-1-PBS targets DNAJC6/AUXILIN in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16612

  Product name: Recombinant human DNAJC6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 387-733 aa of BC109279

  Sequence: IPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHYGQSGFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPTGSSHGTPTHQSKPQTL

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 6
• Calculated Molecular Weight: 970 aa, 106 kDa
• Observed Molecular Weight: 100-110 kDa, 86 kDa
• GenBank Accession Number: BC109279
• Gene Symbol: DNAJC6/AUXILIN
• Gene ID (NCBI): 9829
• RRID: AB_2878951
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75061
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNAJC6, also named AUXILIN, belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. It is a neuronal protein that functions specifically in the pathway of clathrin-mediated endocytosis. It shares homology with GAK, and the two proteins act as cochaperones to support the HSC70 -dependent clathrin uncoating of clathrin-coated vesicles (PMID: 2016009). DNAJC6 is expressed in various brain regions, including cerebellum, corpus callosum, cortex, striatum, brainstem, pons, putamen, spinal cord and substantia nigra (PMID: 23211418).