DNAJC7 Polyclonal antibody

• 

  WB analysis using 11090-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11090-1-AP (DNAJC7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 11090-1-AP

  IP result of anti-DNAJC7 (IP:11090-1-AP, 4ug; Detection:11090-1-AP 1:8000) with HEK-293 cells lysate 1440 ug.

• 

  IHC staining of human pancreas cancer using 11090-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11090-1-AP (DNAJC7 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 11090-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11090-1-AP (DNAJC7 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 11090-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DNAJC7 antibody (11090-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

DNAJC7 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11090-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

CCRP, DANJC7, DNAJC 7, TPR2, TTC2

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, Jurkat cells, moust testis
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

11090-1-AP targets DNAJC7 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1572

  Product name: Recombinant human DNAJC7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 145-494 aa of BC011837

  Sequence: YEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 7
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC011837
• Gene Symbol: DNAJC7
• Gene ID (NCBI): 7266
• RRID: AB_2293179
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99615
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DnaJC7, otherwise referred to as Tpr2 or CCRP, is a conserved, type of J protein that is highly expressed within the brain. DnaJC7 has been found to modulate the flow of substrates from Hsp70 to Hsp90, providing a control mechanism in proteins such as glucocorticoids and progesterone receptor.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	CoIP	Nat Commun; DnaJC7 binds natively folded structural elements in tau to inhibit amyloid formation.; Authors - Zhiqiang Hou
human	WB,IF	Biochem Pharmacol; Indirect activation of constitutive androstane receptor in three-dimensionally cultured HepG2 cells.; Authors - Kosuke Yokobori ; KO Validated
human	WB	Biochem Biophys Res Commun; Co-chaperon DnaJC7/TPR2 enhances p53 stability and activity through blocking the complex formation between p53 and MDM2.; Authors - Kubo Natsumi N
human	WB	bioRxiv; DnaJC7 specifically regulates tau seeding; Authors - Valerie A Perez ; KO Validated
human	WB	Elife; DnaJC7 specifically regulates tau seeding; Authors - Valerie Ann Perez
human	WB	Cancers (Basel); Mutant p53 Depletion by Novel Inhibitors for HSP40/J-Domain Proteins Derived from the Natural Compound Plumbagin; Authors - Mohamed Alalem