CoraLite® Plus 488-conjugated DNAJC7 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-11090

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 DNAJC7 antibody (CL488-11090) at dilution of 1:200, CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

DNAJC7 Polyclonal Antibody for IF/ICC

Cat No. CL488-11090

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

TTC2, TPR2, DNAJC 7, DANJC7, CCRP

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11090 targets DNAJC7 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1572

  Product name: Recombinant human DNAJC7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 145-494 aa of BC011837

  Sequence: YEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 7
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC011837
• Gene Symbol: DNAJC7
• Gene ID (NCBI): 7266
• RRID: AB_3672481
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99615
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DnaJC7, otherwise referred to as Tpr2 or CCRP, is a conserved, type of J protein that is highly expressed within the brain. DnaJC7 has been found to modulate the flow of substrates from Hsp70 to Hsp90, providing a control mechanism in proteins such as glucocorticoids and progesterone receptor.