DNMT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DNMT1 Polyclonal antibody, PBS Only (24206-1-PBS)

• 

  WB analysis using 24206-1-AP (same clone as 24206-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24206-1-AP (DNMT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24206-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 24206-1-AP (same clone as 24206-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24206-1-AP (DNMT1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24206-1-PBS in a different storage buffer formulation.

• 

  WB analysis of C6 using 24206-1-AP (same clone as 24206-1-PBS)

  C6 cells were subjected to SDS PAGE followed by western blot with 24206-1-AP (DNMT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24206-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 24206-1-AP (same clone as 24206-1-PBS)

  IP result of anti-DNMT1 (IP:24206-1-AP, 4ug; Detection:24206-1-AP 1:500) with HEK-293 cells lysate 1400 ug. This data was developed using the same antibody clone with 24206-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DNMT1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 24206-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IP, Indirect ELISA

Synonyms

AIM, CXXC9, CXXC-type zinc finger protein 9, DNA (cytosine-5)-methyltransferase 1, DNMT

---

Product Information

24206-1-PBS targets DNMT1 in WB, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19116

  Product name: Recombinant human DNMT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1288-1632 aa of BC126227

  Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD

• Full Name: DNA (cytosine-5-)-methyltransferase 1
• Calculated Molecular Weight: 1632 aa, 185 kDa
• Observed Molecular Weight: 180-200 kDa
• GenBank Accession Number: BC126227
• Gene Symbol: DNMT1
• Gene ID (NCBI): 1786
• RRID: AB_2879457
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P26358
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. DNMT1 exists some isoforms with MW 184 kDa and 145 kDa. (PMID: 10753866)