DNMT1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68485-1-Ig (same clone as 68485-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68485-1-Ig (DNMT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68485-1-PBS in a different storage buffer formulation.

DNMT1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68485-1-PBS

Clone No.2G5C5

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, Indirect ELISA

Synonyms

AIM, CXXC9, DNA methyltransferase HsaI, DNA MTase HsaI, DNMT, DNMT1, FLJ16293, M.HsaI, MCMT

---

Product Information

68485-1-PBS targets DNMT1 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19116

  Product name: Recombinant human DNMT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1288-1632 aa of BC126227

  Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD

• Full Name: DNA (cytosine-5-)-methyltransferase 1
• Calculated Molecular Weight: 1632 aa, 185 kDa
• Observed Molecular Weight: 180-200 kDa
• GenBank Accession Number: BC126227
• Gene Symbol: DNMT1
• Gene ID (NCBI): 1786
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P26358
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. DNMT1 exists some isoforms with MW 184 kDa and 145 kDa. (PMID: 10753866)