DOCK180 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DOCK180 Polyclonal antibody (23421-1-AP)

DOCK180 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 23421-1-AP Copied!

Publications (8)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ced5, dedicator of cytokinesis 1, DOCK1, DOCK180

• 

  WB analysis of HEK-293 using 23421-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 23421-1-AP (DOCK180 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 23421-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 23421-1-AP (DOCK180 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of LNCaP using 23421-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 23421-1-AP (DOCK180 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 23421-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 23421-1-AP (DOCK180 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 23421-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23421-1-AP (DOCK180 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 23421-1-AP

  IP result of anti-DOCK180 (IP:23421-1-AP, 4ug; Detection:23421-1-AP 1:1000) with HeLa cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 23421-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon slide using 23421-1-AP (DOCK180 antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 23421-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon slide using 23421-1-AP (DOCK180 antibody at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 23421-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 23421-1-AP (DOCK180 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DOCK180 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, LNCaP cells, MCF-7 cells, A431 cells, HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23421-1-AP targets DOCK180 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18069

  Product name: Recombinant human DOCK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1565-1865 aa of BC146857

  Sequence: KDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVDSGIVQ

• Full Name: dedicator of cytokinesis 1
• Calculated Molecular Weight: 1865 aa, 215 kDa
• Observed Molecular Weight: 215 kDa
• GenBank Accession Number: BC146857
• Gene Symbol: DOCK1
• Gene ID (NCBI): 1793
• RRID: AB_2879276
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14185
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DOCK180 Polyclonal antibody (Cat# 23421-1-AP) has 8 citations published in journals including Biomaterials, Cell Death & Disease, Diabetes, Journal of Cell Biology, Experimental Cell Research, Acta Otolaryngologica, bioRxiv, and Advanced Healthcare Materials. Research fields span mechanotransduction, hepatocarcinoma, diabetic wound healing, Schwann cell myelination, colorectal cancer progression, auditory nerve development, and osteoarthritis repair. All cited applications are Western blot in human, mouse, or zebrafish samples.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biomaterials; Stiffness assisted cell-matrix remodeling trigger 3D mechanotransduction regulatory programs; Authors - Anna L Kersey
mouse	WB	Cell Death Dis; Annexin A5 regulates hepatocarcinoma malignancy via CRKI/II-DOCK180-RAC1 integrin and MEK-ERK pathways.; Authors - Xujuan Sun
mouse	WB	Diabetes; Dedicator of Cytokinesis 5 Regulates Keratinocyte Function and Promotes Diabetic Wound Healing.; Authors - Hua Qu
mouse	WB	J Cell Biol; Dock1 functions in Schwann cells to regulate development, maintenance, and repair; Authors - Ryan A Doan ; KD Validated
human	WB	Exp Cell Res; Acetylation of ELMO1 correlates with Rac1 activity and colorectal cancer progress; Authors - Chuangkun Li
mouse	WB	Acta Otolaryngol; C1QL1 regulates auditory nerve fibers growth via ELMO1-DOCK180-RAC1 integrin; Authors - Minglin Chen

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

One reviewer (K. Pang) rated this antibody 5 stars for Western Blot on human liver cells. They used a 1:500 dilution with 5% BSA in TBST as blocking buffer, incubating at 4°C overnight. The review was posted in October 2023 for lot 00019025. Overall, the single review reflects a positive experience with straightforward WB protocol conditions.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

k. (Verified Customer) (10-26-2023)

I used it for WB with 5% BSA+TBST at 4°C overnight.

• Applications: Western Blot
• Primary Antibody Dilution: 1;500
• Cell Tissue Type: Human Liver cells