DOCK1 Monoclonal antibody

• 

  WB analysis using 67296-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67296-1-Ig (DOCK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67296-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67296-1-Ig (DOCK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 67296-1-Ig

  WB result of DOCK1 antibody (67296-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DOCK1 transfected HEK-293 cells.

• Featured Product
• KD/KO Validated

DOCK1 Monoclonal Antibody for WB, ELISA

Cat No. 67296-1-Ig

Clone No.1C3F12

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

DOCK180, 1C3F12

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HSC-T6 cells, HepG2 cells, 4T1 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67296-1-Ig targets DOCK1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18069

  Product name: Recombinant human DOCK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1565-1865 aa of BC146857

  Sequence: KDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVDSGIVQ

• Full Name: dedicator of cytokinesis 1
• Calculated Molecular Weight: 1865 aa, 215 kDa
• Observed Molecular Weight: 215 kDa
• GenBank Accession Number: BC146857
• Gene Symbol: DOCK1
• Gene ID (NCBI): 1793
• RRID: AB_2882560
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14185
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DOCK1, also named as DOCK180, belongs to the DOCK family. It is involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. DOCK1 functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1