DOCK1 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 67296-1-Ig (same clone as 67296-1-PBS)

  WB result of DOCK1 antibody (67296-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DOCK1 transfected HEK-293 cells. This data was developed using the same antibody clone with 67296-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67296-1-Ig (same clone as 67296-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67296-1-Ig (DOCK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67296-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67296-1-Ig (same clone as 67296-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67296-1-Ig (DOCK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67296-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DOCK1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67296-1-PBS

Clone No.1C3F12

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

DOCK180, 1C3F12

---

Product Information

67296-1-PBS targets DOCK1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18069

  Product name: Recombinant human DOCK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1565-1865 aa of BC146857

  Sequence: KDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVDSGIVQ

• Full Name: dedicator of cytokinesis 1
• Calculated Molecular Weight: 1865 aa, 215 kDa
• Observed Molecular Weight: 215 kDa
• GenBank Accession Number: BC146857
• Gene Symbol: DOCK1
• Gene ID (NCBI): 1793
• RRID: AB_2882560
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14185
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DOCK1, also named as DOCK180, belongs to the DOCK family. It is involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. DOCK1 functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1