DOCK10 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86866-1-RR (same clone as 86866-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86866-1-RR (DOCK10 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86866-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 86866-1-RR (same clone as 86866-1-PBS)

  IP result of anti-DOCK10 (IP:86866-1-RR, 4ug; Detection:86866-1-RR 1:1000) with HeLa cells lysate 920 ug. This data was developed using the same antibody clone with 86866-1-PBS in a different storage buffer formulation.

DOCK10 Uni-rAb^® Recombinant Antibody for WB, IP, Indirect ELISA

Cat No. 86866-1-PBS

Clone No.251795G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

dedicator of cytokinesis 10, DRIP2, Nbla10300, ZIZ3, Zizimin 3

---

Product Information

86866-1-PBS targets DOCK10 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10486

  Product name: Recombinant human DOCK10 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 194-542 aa of BC015018

  Sequence: AVFEKQRDFKKLSDLYYDIHRSYLKVAEVVNSEKRLFGRYYRVAFYGQGFFEEEEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKEIEDRKTDFEMHHNINRFVFETPFTLSGKKHGGVAEQCKRRTILTTSHLFPYVKKRIQVISQSSTELNPIEVAIDEMSKKVSELNQLCTMEEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEETNAKKYPDNQVKLLKEIFRQFADACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTVMNEQITGRDDLSKRGVDQTCTRVISKATPALPTVSISSSAEV

• Full Name: dedicator of cytokinesis 10
• Calculated Molecular Weight: 542 aa, 62 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC015018
• Gene Symbol: DOCK10
• Gene ID (NCBI): 55619
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96BY6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DOCK10 (Dedicator of Cytokinesis 10) is a protein-coding gene that belongs to the DOCK family of guanine nucleotide exchange factors (GEFs). It is involved in regulating the activity of Rho GTPases, particularly Rac1 and Cdc42, which play crucial roles in various cellular processes.