DOCK10 Recombinant monoclonal antibody

• 

  WB analysis using 86866-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86866-1-RR (DOCK10 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 86866-1-RR

  IP result of anti-DOCK10 (IP:86866-1-RR, 4ug; Detection:86866-1-RR 1:1000) with HeLa cells lysate 920 ug.

DOCK10 Uni-rAb^® Recombinant Antibody for WB, IP, ELISA

Cat No. 86866-1-RR

Clone No.251795G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

dedicator of cytokinesis 10, DRIP2, Nbla10300, ZIZ3, Zizimin 3

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86866-1-RR targets DOCK10 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10486

  Product name: Recombinant human DOCK10 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 194-542 aa of BC015018

  Sequence: AVFEKQRDFKKLSDLYYDIHRSYLKVAEVVNSEKRLFGRYYRVAFYGQGFFEEEEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKEIEDRKTDFEMHHNINRFVFETPFTLSGKKHGGVAEQCKRRTILTTSHLFPYVKKRIQVISQSSTELNPIEVAIDEMSKKVSELNQLCTMEEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEETNAKKYPDNQVKLLKEIFRQFADACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTVMNEQITGRDDLSKRGVDQTCTRVISKATPALPTVSISSSAEV

• Full Name: dedicator of cytokinesis 10
• Calculated Molecular Weight: 542 aa, 62 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC015018
• Gene Symbol: DOCK10
• Gene ID (NCBI): 55619
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96BY6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DOCK10 (Dedicator of Cytokinesis 10) is a protein-coding gene that belongs to the DOCK family of guanine nucleotide exchange factors (GEFs). It is involved in regulating the activity of Rho GTPases, particularly Rac1 and Cdc42, which play crucial roles in various cellular processes.