Product Information
34200-1-PBS targets DOLPP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag40783 Product name: Recombinant human DOLPP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 183-238 aa of BC033686 Sequence: TQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ Predict reactive species |
| Full Name | dolichyl pyrophosphate phosphatase 1 |
| Calculated Molecular Weight | 238 aa, 27 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC033686 |
| Gene Symbol | DOLPP1 |
| Gene ID (NCBI) | 57171 |
| RRID | AB_3743171 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q86YN1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
DOLPP1 (Dolichyl Pyrophosphate Phosphatase 1) is a multiple-pass transmembrane protein localized to the endoplasmic reticulum membrane and serves as a key regulatory enzyme in the N-glycosylation pathway. This enzyme catalyzes the dephosphorylation of dolichyl pyrophosphate (Dol-PP) to generate dolichyl phosphate (Dol-P), thereby facilitating the recycling of glycosyl carrier lipids, which is essential for maintaining N-glycosylation efficiency and optimal levels of lipid-linked oligosaccharides (LLO). Deficiency of DOLPP1 leads to the accumulation of Dol-PP and depletion of Dol-P, resulting in protein glycosylation defects and endoplasmic reticulum stress. Studies have shown that DOLPP1 forms a functional network with glycosylation-related proteins such as MPDU1 and DPM1/2/3, participating in metabolic disorders associated with congenital disorders of glycosylation (CDG), and acts as an important regulator of the cellular secretory pathway and protein quality control.









