DPCR1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84567-2-RR (same clone as 84567-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84567-2-RR (DPCR1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84567-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 84567-2-RR (same clone as 84567-2-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 84567-2-RR (DPCR1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84567-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84567-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84567-2-RR against Human DPCR1 were performed. The affinity constant is 3.68 nM.

DPCR1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84567-2-PBS

Clone No.241974D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

PBLT, MUCL3, C6orf37, 241974D11

---

Product Information

84567-2-PBS targets DPCR1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33318

  Product name: Recombinant human DPCR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 70-448 aa of NM_080870

  Sequence: DHIVLHSGQRPPELPKSTEIHEQKRHCNTTRHSKPTDKPTGNSKTIDHKSSTDNHEAPPTSEENSSNQGKDPMIRNQRSVDPADSTTTHKESAGKKHITPAPKSKINCRKSTTGKSTVTRKSDKTGRPLEKSMSTLDKTSTSSHKTTTSFHNSGNSQTKQKSTSFPEKITAASKTTYKTTGTPEESEKTEDSRTTVASDKLLTKTTKNIQETISANELTQSLAEPTEHGGRTANENNTPSPAEPTENRERTANENKKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKGIHAGQMGENDSFPAWA

• Full Name: diffuse panbronchiolitis critical region 1
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: NM_080870
• Gene Symbol: DPCR1
• Gene ID (NCBI): 135656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q3MIW9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Diffuse panbronchiolitis critical region 1 (DPCR1) is located in the major histocompatibility complex (MHC) class I. DPCR1 is downregulated in invasive pituitary adenoma compared with that in non-invasive tumors, but upregulated in the precursor of gastric carcinogenesis (PMID: 29242154).