DPEP1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• DPEP1 Recombinant monoclonal antibody (87384-1-RR)

DPEP1 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87384-1-RR

Clone No.252686H3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Beta-lactamase, Dehydropeptidase-I, EC:3.4.13.19, EC:3.5.2.6, hRDP

• 

  WB analysis of human testis using 87384-1-RR

  human testis tissue were subjected to SDS PAGE followed by western blot with 87384-1-RR (DPEP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 87384-1-RR

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 87384-1-RR (DPEP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87384-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87384-1-RR against Human DPEP1 were performed. The affinity constant is 40.7 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87384-1-RR targets DPEP1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5510

  Product name: Recombinant Human DPEP1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 17-385 aa of NM_001128141.3

  Sequence: DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

• Full Name: dipeptidase 1 (renal)
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: NM_001128141.3
• Gene Symbol: DPEP1
• Gene ID (NCBI): 1800
• RRID: AB_3745503
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16444
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DPEP1(Dipeptidase 1) is also named as MDP, RDP and belongs to the peptidase M19 family. It is a glycoprotein that plays an important role in the regulation of leukotriene activity. DPEP1 converts lekotriene D4 to leukotriene E4.