DPF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DPF1 Polyclonal antibody, PBS Only (21769-1-PBS)

• 

  WB analysis using 21769-1-AP (same clone as 21769-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21769-1-AP (DPF1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21769-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 21769-1-AP (same clone as 21769-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using DPF1 antibody (21769-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 21769-1-PBS in a different storage buffer formulation.

DPF1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 21769-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

21769-1-PBS targets DPF1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16409

  Product name: Recombinant human DPF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 84-193 aa of BC125153

  Sequence: LNILEDPRLRPCEYKIDCEAPLKKEGGLPEGPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDRDK

• Full Name: D4, zinc and double PHD fingers family 1
• Calculated Molecular Weight: 414 aa, 47 kDa
• Observed Molecular Weight: 38-47 kDa
• GenBank Accession Number: BC125153
• Gene Symbol: DPF1
• Gene ID (NCBI): 8193
• RRID: AB_3085672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92782
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.