DPP4/CD26 Polyclonal antibody

DPP4/CD26 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 29403-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

CD26, dipeptidyl peptidase 4, ADCP-2, ADCP2, ADCP 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, HT-29 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29403-1-AP targets DPP4/CD26 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30160

Product name: Recombinant human DPP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 30-181 aa of BC013329

Sequence: TDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSY

Predict reactive species
Full Name dipeptidyl-peptidase 4
Calculated Molecular Weight 88 kDa
Observed Molecular Weight110 kDa
GenBank Accession NumberBC013329
Gene Symbol DPP4
Gene ID (NCBI) 1803
RRIDAB_2918296
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP27487
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD26, also known as DPP4 (dipeptidyl peptidase-4), is a 110 kDa type II cell-surface glycoprotein widely expressed on T cells, activated B cells, activated NK cells and myeloid cells as well as on epithelial cells, fibroblasts, mesothelium, and endothelial cells of a variety of tissues (PMID:33777580; 26919392). It has ecto-enzyme activity in its extracellular domain and cleaves amino-terminal dipeptides with either L-proline or L-alanine at the penultimate position (PMID: 9553764). CD26 plays roles in diverse biological processes such as immunoregulation, glucose homeostasis, and tumorigenesis (PMID: 33777580). In addition to the 110 kDa monomeric form, a 290 kDa active dimeric form and a 60 kDa fragment of CD26 have also been reported (PMID: 9654125; 7905271).

Protocols

Product Specific Protocols
IHC protocol for DPP4/CD26 antibody 29403-1-APDownload protocol
WB protocol for DPP4/CD26 antibody 29403-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Biochim Biophys Acta Mol Cell Res

Identification and validation of an immunotherapeutic signature for colon cancer based on the regulatory patterns of ferroptosis and their association with the tumor microenvironment

Authors - Yong Liu
mouseWB

Front Allergy

High-fat diet and palmitic acid amplify airway type 2 inflammation

Authors - Kris Genelyn Dimasuay
mouseWB

Biomed Pharmacother

Fructus Lycii and Salvia miltiorrhiza Bunge extract attenuate oxidative stress-induced photoreceptor ferroptosis in retinitis pigmentosa

Authors - Yijing Yang
humanIHC

J Transl Med

Characterization of the proteome of stable and unstable carotid atherosclerotic plaques using data-independent acquisition mass spectrometry

Authors - Zhichao Lai
humanWB

Anal Chem

Ultrasensitive Fluorescent Probes Reveal an Adverse Action of Dipeptide Peptidase IV and Fibroblast Activation Protein during Proliferation of Cancer Cells

Authors - Qiuyu Gong
human,mouseWB

Cancer Prev Res (Phila)

Stool Protein Mass Spectrometry Identifies Biomarkers for Early Detection of Diffuse-type Gastric Cancer

Authors - Chi-Lee C Ho
Loading...
||
New chat Able
正在加载,请稍候...