CRMP4 Polyclonal antibody

• 

  WB analysis of SH-SY5Y using 18969-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 18969-1-AP (CRMP4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 18969-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 18969-1-AP (CRMP4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 18969-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 18969-1-AP (CRMP4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse cerebellum using 18969-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 18969-1-AP (CRMP4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 18969-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 18969-1-AP (CRMP4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of SH-SY5Y using 18969-1-AP

  IP result of anti-CRMP4 (IP:18969-1-AP, 3ug; Detection:18969-1-AP 1:700) with SH-SY5Y cells lysate 3000ug.

• 

  IHC staining of human liver cancer using 18969-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18969-1-AP (CRMP4 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 18969-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18969-1-AP (CRMP4 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 18969-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 18969-1-AP (CRMP4 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 18969-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18969-1-AP (CRMP4 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 18969-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18969-1-AP (CRMP4 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 18969-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CRMP4 antibody (18969-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

CRMP4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18969-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

DPYSL3, DRP-3, DPYSL 3, Dihydropyrimidinase-related protein 3, CRMP-4

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, Jurkat cells, mouse cerebellum tissue, mouse thymus tissue
• Positive IP detected in: SH-SY5Y cells
• Positive IHC detected in: human liver cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IP: See 1 publications below

Product Information

18969-1-AP targets CRMP4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5299

  Product name: Recombinant human DPYSL3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 221-570 aa of BC039006

  Sequence: EGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS

• Full Name: dihydropyrimidinase-like 3
• Calculated Molecular Weight: 570 aa, 62 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC039006
• Gene Symbol: CRMP4
• Gene ID (NCBI): 1809
• RRID: AB_10603361
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14195
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DPYSL3(Dihydropyrimidinase-related protein 3) is also named as CRMP4, DRP3, ULIP, ULIP1 and belongs to the hydantoinase/dihydropyrimidinase subfamily.DPYSL3 is a developmentally regulated protein, strongly expressed in early embryonic post-mitotic neural cells, reaching a peak of expression around the first post-natal week. In the adult brain, DPYSL3 is present mainly in regions that retain neurogenesis.DPYSL3 protein is also found in synaptic sites at the adult neuromuscular junction where it may be involved in the maintenance of neuronal stability(PMID: 16135096).It has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Free Radic Biol Med; Proteomic analysis of the glutathione-deficient LEGSKO mouse lens reveals activation of EMT signaling, loss of lens specific markers, and changes in stress response proteins.; Authors - Jeremy A Whitson
rat	WB, IP	Biochem Biophys Res Commun; Up-regulation of DRP-3 long isoform during the induction of neural progenitor cells by glutamate treatment in the ex vivo rat retina.; Authors - Kazuhiro Tokuda