DRAP1 Polyclonal antibody

• 

  WB analysis using 11020-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11020-1-AP (DRAP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 11020-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11020-1-AP (DRAP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11020-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11020-1-AP (DRAP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 11020-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 11020-1-AP (DRAP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 11020-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11020-1-AP (DRAP1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HepG2 using 11020-1-AP

  Immunofluorescent analysis of HepG2 cells, using DRAP1 antibody 11020-1-AP at 1:100 dilution and FITC-labeled donkey anti-rabbit IgG(green). Blue pseudocolor = DAPI (fluorescent DNA dye).

DRAP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11020-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

NC2-alpha, NC2 alpha, Dr1-associated protein 1, Dr1-associated corepressor, Dr1 associated protein 1

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human heart tissue, human brain tissue, mouse kidney tissue, rat testis tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11020-1-AP targets DRAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1470

  Product name: Recombinant human DRAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of BC010025

  Sequence: MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS

• Full Name: DR1-associated protein 1 (negative cofactor 2 alpha)
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC010025
• Gene Symbol: DRAP1
• Gene ID (NCBI): 10589
• RRID: AB_2277501
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14919
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.