DRG1 Polyclonal antibody, PBS Only

• 

  WB analysis using 13190-1-AP (same clone as 13190-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13190-1-AP (DRG1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 13190-1-AP (same clone as 13190-1-PBS)

  WB result of DRG1 antibody (13190-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DRG1 transfected K-562 cells. This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-12 using 13190-1-AP (same clone as 13190-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 13190-1-AP (DRG1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 13190-1-AP (same clone as 13190-1-PBS)

  IP result of anti-DRG1 (IP:13190-1-AP, 4ug; Detection:13190-1-AP 1:600) with K-562 cells lysate 4400 ug. This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat skeletal muscle using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat skeletal muscle using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13190-1-AP (same clone as 13190-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13190-1-AP (DRG1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 13190-1-AP (same clone as 13190-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 13190-1-AP (DRG1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13190-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DRG1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 13190-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

13190-1-PBS targets DRG1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3866

  Product name: Recombinant human DRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-367 aa of BC020803

  Sequence: MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEAAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK

• Full Name: developmentally regulated GTP binding protein 1
• Calculated Molecular Weight: 367 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC020803
• Gene Symbol: DRG1
• Gene ID (NCBI): 4733
• RRID: AB_2095275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y295
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.