CoraLite® Plus 488-conjugated DSC2 Recombinant monoclonal antibody

• 

  IF Staining of Caco-2 using CL488-84985

  Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using CoraLite® Plus 488 DSC2 antibody (CL488-84985, Clone: 241084G9 ) at dilution of 1:200.

• 

  IF Staining of MCF-7 using CL488-84985

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CoraLite® Plus 488 DSC2 antibody (CL488-84985, Clone: 241084G9 ) at dilution of 1:200.

DSC2 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84985

Clone No.241084G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

Desmocollin 2, 241084G9, ARVD11, Cadherin family member 2, CDHF2

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells, Caco-2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84985 targets DSC2 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4956

  Product name: Recombinant human DSC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-357 aa of BC063291

  Sequence: LIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTR

• Full Name: desmocollin 2
• Calculated Molecular Weight: 100 kDa
• GenBank Accession Number: BC063291
• Gene Symbol: Desmocollin 2
• Gene ID (NCBI): 1824
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02487
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Desmocollin 2 (DSC2) is a member of the desmocollin subfamily of the cadherin superfamily. The desmocollins (DSC1-3), along with the desmogleins (DSG1-4), are found primarily in epithelial and cardiac muscle where they constitute the adhesive proteins of the intercellular desmosome junctions and are required for cell adhesion and desmosome formation. Mutations in the DSC2 gene are associated with arrhythmogenic right ventricular dysplasia-11.