DSG3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DSG3 Polyclonal antibody, PBS Only (29942-1-PBS)

• 

  WB analysis using 29942-1-AP (same clone as 29942-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29942-1-AP (DSG3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29942-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse tongue using 29942-1-AP (same clone as 29942-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse tongue tissue slide using 29942-1-AP (DSG3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29942-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse tongue using 29942-1-AP (same clone as 29942-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse tongue tissue slide using 29942-1-AP (DSG3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29942-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung squamous cell carcinoma using 29942-1-AP (same clone as 29942-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung squamous cell carcinoma tissue slide using 29942-1-AP (DSG3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29942-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HaCaT using 29942-1-AP (same clone as 29942-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HaCaT cells using DSG3 antibody (29942-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red). This data was developed using the same antibody clone with 29942-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HaCaT using 29942-1-AP (same clone as 29942-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using DSG3 antibody (29942-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red). This data was developed using the same antibody clone with 29942-1-PBS in a different storage buffer formulation.

DSG3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29942-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PVA, DSG 3, Desmoglein-3, Desmoglein 3, CDHF6

---

Product Information

29942-1-PBS targets DSG3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30880

  Product name: Recombinant human DSG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 760-880 aa of NM_001944

  Sequence: SGQSGTMRTRHSTGGTNKDYADGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADDLDDSFLDSLGPKFKKLAEISLGVDGEGKEVQPPSKDSGYG

• Full Name: desmoglein 3 (pemphigus vulgaris antigen)
• Calculated Molecular Weight: 108 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: NM_001944
• Gene Symbol: DSG3
• Gene ID (NCBI): 1830
• RRID: AB_3086196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32926
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DSG3, Desmoglein-3, is the component of intercellular desmosome junctions. Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG3 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. DSG3 is expressed in the basal lower layers of in the skin epidermis (PMID: 30528827). It acts as a prognostic marker of Esophageal Squamous cell carcinoma (PMID:24568510).