DST Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DST Polyclonal antibody, PBS Only (28438-1-PBS)

• 

  WB analysis using 28438-1-AP (same clone as 28438-1-PBS)

  Mouse brain tissue lysates were subjected to SDS PAGE followed by western blot with 28438-1-AP (DST antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28438-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28438-1-AP (same clone as 28438-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28438-1-AP (DST antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28438-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28438-1-AP (same clone as 28438-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28438-1-AP (DST antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28438-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28438-1-AP (same clone as 28438-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28438-1-AP (DST antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28438-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 28438-1-AP (same clone as 28438-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28438-1-AP (DST antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28438-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 28438-1-AP (same clone as 28438-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28438-1-AP (DST antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28438-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 28438-1-AP (same clone as 28438-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using DST antibody (28438-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28438-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 28438-1-AP (same clone as 28438-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using DST antibody (28438-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 28438-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 28438-1-AP (same clone as 28438-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using DST antibody (28438-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 28438-1-PBS in a different storage buffer formulation.

DST Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28438-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DMH, D6S1101, CATX 15, BPAG1, BPA

---

Product Information

28438-1-PBS targets DST in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28833

  Product name: Recombinant human DST protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 420-610 aa of NM_001144769

  Sequence: SGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQD

• Full Name: dystonin
• Calculated Molecular Weight: 861 kDa
• GenBank Accession Number: NM_001144769
• Gene Symbol: DST
• Gene ID (NCBI): 667
• RRID: AB_2881141
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03001
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.